PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3277_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GeBP
Protein Properties Length: 365aa    MW: 40584.9 Da    PI: 5.1269
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3277_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573120.96.3e-3892185298
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                 +fqrlwseeDei++LqG+idfka+tgksp++d+d+fye  +ksisf++sk q+v+Kir+LK+K+ +kv k  +g e s++k+hd ++++l+k iWgs
  RrC3277_p4  92 TFQRLWSEEDEISMLQGMIDFKADTGKSPYEDMDRFYELTSKSISFEASKIQFVDKIRSLKRKYIGKVMK--QGVE-SLTKAHDIQCLKLAKYIWGS 185
                 79******************************************************************99..6666.9*****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.5E-2893184IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MTRKKLNPLE DPPTASSSDE DELEPLPGDD EEEQISDDSS SDDLMSPVNI PSSKKSKSEK  60
PIAVTVKKRP IETTSVSAKR AKIAEEAKKP TTFQRLWSEE DEISMLQGMI DFKADTGKSP  120
YEDMDRFYEL TSKSISFEAS KIQFVDKIRS LKRKYIGKVM KQGVESLTKA HDIQCLKLAK  180
YIWGSHGMAL DSNVKKTEKK VAAEEEVVTP ESNGTPKKSK KKPISVEGNG DKVEVGREVL  240
VNGDNGGEDR QVLAGGEKGR EDREVLVNGD KVEEDKEVLT NAGGASKSLG VMRASDWFEH  300
SFLVGSIAGL GVSEQFVKEK WSMVTVETKK RMEEKWKLLQ AKEMELVLQK TDFMREIGSV  360
IAESS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1215222PKKSKKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013723127.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D3BYZ30.0A0A0D3BYZ3_BRAOL; Uncharacterized protein
STRINGBra032717.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.16e-66DNA-binding storekeeper protein-related transcriptional regulator