PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3108_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Nin-like
Protein Properties Length: 764aa    MW: 85799.6 Da    PI: 6.0498
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3108_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.11.8e-28512562252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  k+i+l++l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  RrC3108_p1 512 DKTITLDVLRQHFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 562
                 689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.018499582IPR003035RWP-RK domain
PfamPF020422.5E-25514562IPR003035RWP-RK domain
SuperFamilySSF542771.08E-22663758No hitNo description
PROSITE profilePS5174527.639673756IPR000270PB1 domain
SMARTSM006661.0E-26673756IPR000270PB1 domain
PfamPF005646.7E-19674755IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-20674753No hitNo description
CDDcd064077.50E-42674754No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    Send to blast
MEDSNYLQTE NTVMDNEFMD GLLLDGCWLE TTDGSEFLDL TSSDPSSFMW PPAQDTSAIC  60
TSEVVSQTYG HHDCASLDEF QWNKRWWIGP GGGGSSVKER LVQAVEHIKD YITERGSLIQ  120
LWVPVHRGGK RVLTTKEQPY SHDPTCQRLA NYREISVNYH FSAEQDDSKA LAGLPGRVFL  180
GKLPEWTPDV RFFRSEEYPR VYHAQDCDVR GTLAIPVFEQ GSKVCLGVIE VVMTTEMVKL  240
APELESICRA LQGCDLSYKA ALPEIRNLLR CACETHKLPL AQTWVSCLHQ SKSGCRHNNE  300
NYIHCVSTID DACYLGDPTV REFHEACSEH HLLKGQGVAG QAFLTNGPCF SPDVSNYKKS  360
EYPLSHHANM FGLHGSVAIR LRCIHTGSVD FVLEFFLPKD CDDVEEQRKM LNALSTVMAH  420
VPRSLRIVTD KELEDESEVI VTPKIEITSE HAEDWLHQSS NPQNLGLIFD VGDKASDEFG  480
LKRDFGYTKD SNVNERRTFS SGGVERKRTK ADKTITLDVL RQHFAGSLKD AAKNIGVCPT  540
TLKRICRQHG IQRWPSRKIK KVGHSLQKIQ RVIDSVEGVS GPLPIGSFYS SFPHLASSRE  600
PSIQGKNSLL PHPLQLSKSP VSPYSHSSSS SQCCSSETQL TTTDVGGGVL TLSSLENISQ  660
STNLSSSSQD DDFLRIKVSY GEEKIRFRMG NSRRLTDLLW EIGKRFSIED MSRCDLKYLD  720
EDNEWVLLTC DEDVEECVDV CRTTPSHTIK LLLHVSSHCY SSWQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893460.0AC189346.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042N05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018451304.10.0PREDICTED: protein NLP4-like
RefseqXP_018451305.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A397YP200.0A0A397YP20_BRACM; Uncharacterized protein
STRINGBo8g070310.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein