PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC295_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 121aa    MW: 13793 Da    PI: 8.9603
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC295_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601284.4e-4051041100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaC++lrr+C+kdCv++pyfp ++p+kfa+vh+++Ga nv+k+l++lp ++r +a++sl++eA +r++dPvyG+vg+i+ lq q++++k+ la++++e
  RrC295_p2   5 RCAACRYLRRRCPKDCVFSPYFPPNNPEKFACVHRIYGAGNVSKMLQQLPVQTRAEAVESLCFEATCRIEDPVYGCVGMISLLQTQIQKTKNLLARTQAE 104
                6*******************************************************************************************99999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4334105IPR004883Lateral organ boundaries, LOB
PfamPF031959.5E-405102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MNPKRCAACR YLRRRCPKDC VFSPYFPPNN PEKFACVHRI YGAGNVSKML QQLPVQTRAE  60
AVESLCFEAT CRIEDPVYGC VGMISLLQTQ IQKTKNLLAR TQAEITVAQI KHSQNQHSEF  120
M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-36610512111LOB family transfactor Ramosa2.1
5ly0_B1e-36610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738461e-111AB473846.1 Arabidopsis thaliana ASL13 mRNA for ASYMMETRIC LEAVES2-like 13 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018433035.15e-87PREDICTED: LOB domain-containing protein 24-like
RefseqXP_018433045.15e-87PREDICTED: LOB domain-containing protein 24-like
SwissprotP594681e-74LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A078GTX32e-84A0A078GTX3_BRANA; BnaC02g36230D protein
TrEMBLA0A0D2ZPE82e-84A0A0D2ZPE8_BRAOL; Uncharacterized protein
TrEMBLA0A3P6DFN92e-84A0A3P6DFN9_BRAOL; Uncharacterized protein
STRINGBo00285s360.13e-85(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-65LOB domain-containing protein 24