PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2837_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 150aa    MW: 16315.9 Da    PI: 6.4232
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2837_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.41.6e-21117932100
      DUF260  32 nvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  +hk+FGasn +k+l++lp ++r +a+ ++ yeA+ar++dP+yG+v++i++lqqq+ +l+ +l+ lk++
  RrC2837_p3  11 SIHKVFGASNASKILSNLPISDRCEAAITISYEAQARLQDPIYGCVSHIFALQQQVVNLQGQLEILKQQ 79 
                 69**************************************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.196180IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-201077IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSSSGSPCGA SIHKVFGASN ASKILSNLPI SDRCEAAITI SYEAQARLQD PIYGCVSHIF  60
ALQQQVVNLQ GQLEILKQQA AQSIMFADSP SSENPSSYYG DNTTTPYHHQ EHQNIHHHHH  120
DQTHLVNQTG SSGMVQRGDA IANSYPTENS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-17107441105LOB family transfactor Ramosa2.1
5ly0_B5e-17107441105LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in lateral root formation. Regulated by the transcriptional activators ARF7 and ARF19. {ECO:0000269|PubMed:17259263}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:15659631, ECO:0000269|PubMed:17259263}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738491e-127AB473849.1 Arabidopsis thaliana ASL16 mRNA for ASYMMETRIC LEAVES2-like 16 protein, complete cds.
GenBankAF4478931e-127AF447893.1 Arabidopsis thaliana LOB DOMAIN 29 (LBD29) mRNA, complete cds.
GenBankBT0252821e-127BT025282.1 Arabidopsis thaliana At3g58190 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018461781.12e-82PREDICTED: LOB domain-containing protein 29-like
SwissprotQ9M2J72e-77LBD29_ARATH; LOB domain-containing protein 29
TrEMBLA0A397ZNS05e-79A0A397ZNS0_BRACM; Uncharacterized protein
STRINGBra014581.1-P7e-79(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM10828359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58190.14e-59lateral organ boundaries-domain 29
Publications ? help Back to Top
  1. Gupta A,Singh M,Laxmi A
    Interaction between glucose and brassinosteroid during the regulation of lateral root development in Arabidopsis.
    Plant Physiol., 2015. 168(1): p. 307-20
    [PMID:25810094]
  2. Porco S, et al.
    Lateral root emergence in Arabidopsis is dependent on transcription factor LBD29 regulation of auxin influx carrier LAX3.
    Development, 2016. 143(18): p. 3340-9
    [PMID:27578783]
  3. Lee K,Seo PJ
    High-temperature promotion of callus formation requires the BIN2-ARF-LBD axis in Arabidopsis.
    Planta, 2017. 246(4): p. 797-802
    [PMID:28766014]
  4. Xu C,Cao H,Xu E,Zhang S,Hu Y
    Genome-Wide Identification of Arabidopsis LBD29 Target Genes Reveals the Molecular Events behind Auxin-Induced Cell Reprogramming during Callus Formation.
    Plant Cell Physiol., 2018. 59(4): p. 744-755
    [PMID:29121271]
  5. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]