PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC28160_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 135aa    MW: 15172 Da    PI: 4.5311
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC28160_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26055.32e-1725349100
       DUF260  49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  lp ++r da++slv+eA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++e
  RrC28160_p1   2 LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQAE 53 
                  6889********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.365154IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-15251IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
ELPVHQRADA VNSLVFEANA RVRDPVYGCV GAISYLQNQV SQLQMQLAVA QAEILCIQMQ  60
HEPTLQSHHQ VLELDQDDKA LLLHNNIDNC CNNNNNNLGY AMSSGQFNSN FASPSSIMQM  120
QMQMQDPLKQ ESLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-1916458124LOB family transfactor Ramosa2.1
5ly0_B7e-1916458124LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1643061e-129AB164306.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like gene 5 protein, partial cds.
GenBankAB4738381e-129AB473838.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like 5 protein, complete cds.
GenBankAC0041651e-129AC004165.3 Arabidopsis thaliana chromosome 2 clone T27E13 map m283, complete sequence.
GenBankAY0869601e-129AY086960.1 Arabidopsis thaliana clone 29970 mRNA, complete sequence.
GenBankCP0026851e-129CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018438152.11e-94PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW39e-68LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A078FCQ93e-70A0A078FCQ9_BRANA; BnaA05g12220D protein
TrEMBLA0A291LQZ23e-70A0A291LQZ2_BRARR; Transcription factor LBD12a
TrEMBLA0A397Z9R33e-70A0A397Z9R3_BRACM; Uncharacterized protein
TrEMBLM4DP943e-70M4DP94_BRARP; Uncharacterized protein
STRINGBra018335.1-P6e-71(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-70LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]