PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2709_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 468aa    MW: 51414.8 Da    PI: 7.6383
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2709_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.1e-32148205260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                 +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkve s  +++++ei+Y+g+Hnh+k
  RrC2709_p3 148 EDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVEMSL-EGQITEIVYKGSHNHPK 205
                 7****************************************.***************85 PP

2WRKY1061.9e-33308366159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  RrC2709_p3 308 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTTGCPVRKHVERASHDMRAVITTYEGKHNHD 366
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.6E-27142206IPR003657WRKY domain
SuperFamilySSF1182905.23E-24147206IPR003657WRKY domain
SMARTSM007744.0E-33147205IPR003657WRKY domain
PfamPF031062.4E-24148204IPR003657WRKY domain
PROSITE profilePS5081121.987148206IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-37293368IPR003657WRKY domain
SuperFamilySSF1182902.09E-29300368IPR003657WRKY domain
PROSITE profilePS5081138.595303368IPR003657WRKY domain
SMARTSM007745.5E-39308367IPR003657WRKY domain
PfamPF031067.7E-26309366IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MNGSVNWSQQ TPRTLEDLEI PPKFRSFAPS SISTSPSTCF SPSVFLDSPA FVSSSANVLA  60
SPTTGALITN ESNKKSIAEE EKTNNNNNSL SLFDFSFQTQ SSGLSAPTTT TKTTTNSSVL  120
QWSQTDTRPS NNTHQSVPYN GREQRKGEDG YNWRKYGQKQ VKGSENPRSY YKCTFPSCPT  180
KKKVEMSLEG QITEIVYKGS HNHPKPQSTR RSSSSSSSTF HSAVFNAGLD HHGSSDSFAI  240
QQEDNTTSGS LGDDELSVVS RDEEDCGSEP EAKRWKGENE TNGGNGNGSK TVREPRIVVQ  300
TTSDIDILDD GYRWRKYGQK VVKGNPNPRS YYKCTTTGCP VRKHVERASH DMRAVITTYE  360
GKHNHDVPAA RGSGYTTNRL AHDPSSAPIR PNAIAAHSNY TTSQAPYTLQ MMHNNNNNTN  420
PGPFGYAMNN NNNNIQTQQN NFGGGGFSIA KEEPNEESSS SFFDSFLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-38148369878Probable WRKY transcription factor 4
2lex_A9e-38148369878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931480.0KM593148.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY54) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141743.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P50.0WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A078G1810.0A0A078G181_BRANA; BnaA04g22040D protein
STRINGBra017117.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.10.0WRKY DNA-binding protein 33