PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2542_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 547aa    MW: 60887.4 Da    PI: 4.3324
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2542_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.35.2e-5291361128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 l+pGfrFhPtdeelv +yLk+kv ++++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgkd+e+ + ++
  RrC2542_p4   9 LAPGFRFHPTDEELVRYYLKRKVCNRPFNF-DAISVTDVYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRN-GS 105
                 579**************************9.99**************95347777888*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + vg+kktLv++kgrap+ge+++Wvmheyrl
  RrC2542_p4 106 RGVGMKKTLVYHKGRAPRGERSNWVMHEYRL 136
                 9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-607159IPR003441NAC domain
PROSITE profilePS5100557.8569159IPR003441NAC domain
PfamPF023655.8E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MGRGSVTSLA PGFRFHPTDE ELVRYYLKRK VCNRPFNFDA ISVTDVYKSE PWDLPDKSKL  60
KSRDLEWYFF SMLDKKYSNG SKTNRATEKG YWKTTGKDRE IRNGSRGVGM KKTLVYHKGR  120
APRGERSNWV MHEYRLTDDE LKKTGAPQDA FVLCRIFQKS GTGPKNGEQY GAPYLEEEWE  180
EDTMTFVPQQ DALLSEGLGA DDDDVYLDID EKPENLVVYD AIPVQTNYCH GESSNNVESG  240
NCENSGDYIQ PGNCVVDSGG YSEQPFEAFE EDQKPIIRDG SIQPCSLFPG EQSGCGVEDE  300
DAVNLETSND NVFVADTCYS VDDANYIPDE PFIGHSNNLP ISDDGLQDDF NFEDYLNFLE  360
DEDAQDLSLD VSQLLGSEDT LPDQGLHQKP SPEELEKEVV EKKESGEGSS SKQDADVTDF  420
DSASKYPFLK NMCGVISAPP SFTSQFQTKD AAIRLHAAQS SGSVHVTAGM IRIPNMTADS  480
SMGWLYDKNG NLKVVLSFGL VQRDDAMSST RGKTGGITAT RAVLIFMCFW VLLLSVSFKI  540
GTIVSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-45816516171NO APICAL MERISTEM PROTEIN
1ut4_B8e-45816516171NO APICAL MERISTEM PROTEIN
1ut7_A8e-45816516171NO APICAL MERISTEM PROTEIN
1ut7_B8e-45816516171NO APICAL MERISTEM PROTEIN
3swm_A9e-45816519174NAC domain-containing protein 19
3swm_B9e-45816519174NAC domain-containing protein 19
3swm_C9e-45816519174NAC domain-containing protein 19
3swm_D9e-45816519174NAC domain-containing protein 19
3swp_A9e-45816519174NAC domain-containing protein 19
3swp_B9e-45816519174NAC domain-containing protein 19
3swp_C9e-45816519174NAC domain-containing protein 19
3swp_D9e-45816519174NAC domain-containing protein 19
4dul_A8e-45816516171NAC domain-containing protein 19
4dul_B8e-45816516171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6413560.0KP641356.1 Brassica napus NAC transcription factor 78.1 (NAC78.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018471279.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLV4LD690.0V4LD69_EUTSA; Uncharacterized protein
STRINGXP_006398899.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]