PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC24_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 529aa    MW: 57555 Da    PI: 4.8193
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC24_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.73.1e-25294350259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ +k+v+i+ +g H+he
  RrC24_p1 294 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSECCAKK-IECSNDSGKMVQIVTKGLHTHE 350
               6********************************98.*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.2E-20291352IPR003657WRKY domain
SuperFamilySSF1182901.96E-19292352IPR003657WRKY domain
SMARTSM007743.8E-23293351IPR003657WRKY domain
PfamPF031063.8E-17295350IPR003657WRKY domain
PROSITE profilePS5081117.041295352IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MEKSTEERVK SEKVKPEKEL CDGVSQLRDE ESIGTIGDDM EDVHDEAIRD ILTNDQVEDV  60
RENSPVEPND QDVREESDRS KEDVVPVVMP VVEVAVENSA SSEPSMVEPS LSPAPSAAKG  120
QGLSLLEQKS DSRVVNNLSV SPVLRTDSGK EDLVSGVDEV AVVENCEVDT PPALNPSSDP  180
SMVDPSLPSN PSAAKKAQGL SLPEQKPDSR VVNNVSVSPV LRTDSGKEDV AIAVDEVAVE  240
NREVETSPPG LSKSSDPSVV EPSLPSGLSL LQKSYDSRVV RNLSVSPALR TSPRDGYNWR  300
KYGQKQVKSP KGSRSYYRCT YSECCAKKIE CSNDSGKMVQ IVTKGLHTHE PPRKSSFSPR  360
EIRPASAITP VLEDDAVVVA TVPTSTKENI CQSPTIVERK RHCEAVEEPE PKRRQVLWIL  420
GLNKENTESS VSVSKPGKKH RHVVHAADDV GISGDGYRWP VENTRAVVIT YKGEHNHDTP  480
VPKKGHDTPS SVLLSPTSMR TRLEDQVNQC SVGRESEKQS SEALDVVGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931561e-138KM593156.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY82) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013648032.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-123WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLM4E5I10.0M4E5I1_BRARP; Uncharacterized protein
STRINGBra024035.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-121WRKY DNA-binding protein 32