PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC24660_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 221aa    MW: 25397.8 Da    PI: 7.5886
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC24660_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.43.7e-092521262
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1 12 kNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                  NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  RrC24660_p1  2 ANRQSAARSKERKARYIMELERKVQSLQTEATTLSAQLSLFQRDTTGLSSE 52
                 6**********************************9999887776666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS502179.438156IPR004827Basic-leucine zipper domain
SMARTSM003383.4E-7155IPR004827Basic-leucine zipper domain
CDDcd147033.61E-17145No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-9250No hitNo description
SuperFamilySSF579591.27E-8246No hitNo description
PfamPF001702.5E-7253IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MANRQSAARS KERKARYIME LERKVQSLQT EATTLSAQLS LFQRDTTGLS SENTELKLRL  60
QVMEQQAKLR DALNDQLKKE VERLKFATGE VSHADAYNLG MAHMQYSQQQ QQQPQQQQQQ  120
QSFFQHHHHH HQQQQQQTDA QNIQQMTHQF HLFQPNNNHN QNQNPQLMHH ATSNASGQSH  180
SFAEAMHEDH LGRLQGLDIS SCGRGSNFGR SDTVSESSST M
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742691e-111AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967461e-111AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankZ860931e-111Z86093.1 A.thaliana mRNA for b-Zip DNA binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181594.11e-119Basic-leucine zipper (bZIP) transcription factor family protein
SwissprotO228731e-120BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A178VZR11e-117A0A178VZR1_ARATH; Uncharacterized protein
STRINGAT2G40620.11e-118(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.17e-63bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]