PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2461_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 530aa    MW: 57210 Da    PI: 7.6702
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2461_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.51.8e-1598138141
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                 k+kk+CnCk s+Clk+YCeCfa+g++C++ C+C +C+N+ +
  RrC2461_p4  98 KKKKHCNCKLSRCLKLYCECFASGTYCDDGCNCANCFNNVD 138
                 589***********************************986 PP

2TCR49.21e-15173211240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++kgC+Ckks ClkkYCeCf+a++ Cse+C C dCkN e
  RrC2461_p4 173 NNKGCRCKKSGCLKKYCECFQANVLCSENCGCLDCKNFE 211
                 689**********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.7E-1598139IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.95799212IPR005172CRC domain
PfamPF036382.5E-11100136IPR005172CRC domain
SMARTSM011141.3E-16172213IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.9E-12175210IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MSEGGGGGGG DFPPKKEGLS DESGFSEKKP ARQLDFTGGP DERSLSKPAP TLVTPSVSSP  60
VTSQSLILNA PTKQPEESPK SRARPVVEEG RDGTPQKKKK KHCNCKLSRC LKLYCECFAS  120
GTYCDDGCNC ANCFNNVDNE PARRDAVEAT LDRNPNAFRP KIATSPHGVM RDNNKGCRCK  180
KSGCLKKYCE CFQANVLCSE NCGCLDCKNF EGSEERRALF HGEHANDMAY LQQAANAAIT  240
GAVGSSGFAP FPAPKRRKGQ DISFNQANKD SSTYCLGQFQ QASNGRTSGP TSATSPAKFV  300
YRSLLAEIIQ PQDVKALCSV LVAVAGETTK TLTDKRIETE KRVEDQKETS LASSYNSQGD  360
KDASDVNMVA DDGNQADCSK GKPLSPATLD LMCDERDTIF MVAAAEPNGS RDTGGCGTNS  420
QEPSEICAEQ ERMVLTKFRD CLARLISYAE FKESKCSYLA RRHIHSPSTV PTVTVKTENG  480
IQQTPPVVNG ASLTTTQPAL NKPQPLQETT TTNTSSNHHK PPALQEKKDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-2910022111132Protein lin-54 homolog
5fd3_B3e-2910022111132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018451421.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A3P6C9X10.0A0A3P6C9X1_BRACM; Uncharacterized protein
STRINGBra010348.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein