PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2432_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 351aa    MW: 39899.6 Da    PI: 5.5008
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2432_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.62.1e-38381381101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e +r++am+s+++++ +r r+Pv+G++g+ ++lq  +  +++el+++++
  RrC2432_p4  38 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILENLDEVQRPEAMKSIIFQSYVRDRNPVHGCLGITQQLQYMIWVAEEELKAVNS 136
                 7**********************************************************************************************9998 PP

      DUF260 100 el 101
                 +l
  RrC2432_p4 137 QL 138
                 75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.30437138IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-3538135IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MSQIKTIHNP IGSIERFLDL LLISLIVYMT LKGGTSGACA ACKYQRRRCA ADCPLAPYFP  60
AEQPKLFQNV HRLFGVRSIV KILENLDEVQ RPEAMKSIIF QSYVRDRNPV HGCLGITQQL  120
QYMIWVAEEE LKAVNSQLQL YRNGQNHPNP HNMMIHEIGE KQEDLTSQLD LGMGLPVNTN  180
QGNNTIPFFS PVSETQQLQQ PQHMSYCSEV NNNHDYNPTP DSCKEVLNNH SNTSLAWGQN  240
QFPYNHHHNY GFINQNEHCS ETKNNNNSVM AIQSQLVNLQ MASNQQEEEV DVHNYDEIHQ  300
FLEIIDESQS FTETKEVYAS SSGESSKEPI DGIGEKELRR AATCFSLTSV N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-25341457118LOB family transfactor Ramosa2.1
5ly0_B4e-25341457118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018437785.10.0PREDICTED: LOB domain-containing protein 27
SwissprotQ9STS61e-124LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A078HJA30.0A0A078HJA3_BRANA; BnaA06g17030D protein
TrEMBLA0A3P5YTK10.0A0A3P5YTK1_BRACM; Uncharacterized protein
STRINGBo3g135950.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-126LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]