PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC240_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 324aa    MW: 35452.3 Da    PI: 9.913
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC240_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof101.84.3e-3273132261
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                +e+al+cprC+s ntkfCyynny+ +qPr++CkaCrryWt GG lr++P Gg rr+n k+
  RrC240_p2  73 PEAALNCPRCNSINTKFCYYNNYNPTQPRHYCKACRRYWTDGGKLRDIPEGGRRRRNSKK 132
                67899**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2261121IPR003851Zinc finger, Dof-type
PfamPF027014.8E-3076131IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.61877131IPR003851Zinc finger, Dof-type
PROSITE patternPS01361079115IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVFSSNWSQP TNPSQLQLRE NGSLVNGHEL LSHQLPPFPS NPNIHHAAAS SGLPAMLGGY  60
MAERARQPKA PRPEAALNCP RCNSINTKFC YYNNYNPTQP RHYCKACRRY WTDGGKLRDI  120
PEGGRRRRNS KKNKNGNSKS PSSSSKLPSP TVNAPSSSSG QLGTNHHFPF LPTLQHLTQL  180
GGIGLNLAAA NGSNQAHQFG ASLMNDLGFL HVGDGRNNLA PVTRNIHDND NDNRENNLMG  240
SGGFTLFDPR SGLHAFQNEG NIRNNVSFSP TSMVDSRIYQ TGPVNMEEQP DLVNLSRPVS  300
GLTPPVNQIN QYVWNNSNFS GPSS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842841e-145FJ584284.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018489307.10.0PREDICTED: dof zinc finger protein DOF1.1-like isoform X1
SwissprotQ8L9V61e-124DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A397Y7T51e-163A0A397Y7T5_BRACM; Uncharacterized protein
TrEMBLC5HYF61e-163C5HYF6_BRARP; OBF binding protein 2 Dof1.1-1
STRINGBra031588.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.31e-109Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]