PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2359_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 681aa    MW: 74846.4 Da    PI: 6.2932
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2359_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.32.3e-16392430240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+CnCkkskClk+YCeCfaag++C e C+C dC+N+ 
  RrC2359_p2 392 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNRP 430
                 689**********************************75 PP

2TCR52.88e-17477516140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+gCnCkks+ClkkYCeCf++g+ Cs +C+Ce+CkN  
  RrC2359_p2 477 RHKRGCNCKKSNCLKKYCECFQSGVGCSINCRCEGCKNAF 516
                 589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.4E-19391432IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.515392517IPR005172CRC domain
PfamPF036385.7E-12394429IPR005172CRC domain
SMARTSM011145.7E-17477518IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-12479515IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MDSSQKKKKI ETPTPKSKFE DSPVFNFINN LSPIETVRSI PTVQTFNSLS FTSPPPVFTS  60
PHASFHRESR FFRCHNSVER SKALESLDST QEVVGGASGE VDLNKDATLE EEEEEEETSC  120
GHVDSPPGPG DIVTQVLLDP SGGAPRGEDN ASSSEDVRKI LDAQGENDTP GCGRLMADAA  180
ELLVFRSPND SEAFGCLVDI ISSSERRFCA GVKLTKQHDI TKDVPANDNE PLALVPNQSS  240
VLSLHRGSMR RRCLDFEVLG KRKKDIADDD KQTLGDNKAE SSSKCVVPGI GLHLNAIPMS  300
SKAIKINTRH EGSASVEIQK SFPGSITPVH SQDIMQETLV QAETEAGEGL AVEEETPQPL  360
VFEELNQDSL QKKKQVFFLE KRKVEEPGEG DSCKRCNCKK SKCLKLYCEC FAAGVYCIEP  420
CSCVDCFNRP IHEDTVLATR KQIESRNPLA FAPKVIRNSD SIMETSDDAS KTPASARHKR  480
GCNCKKSNCL KKYCECFQSG VGCSINCRCE GCKNAFGKKE AYLLAIMESK QEEDVSKIQQ  540
NSDLPKEVEQ NPSSDQPSTP LPPYRHMVVH QPFLSKNRLP PTQFFLGAGS SSFRKPDRDL  600
TQARIDKKPL ETVAEDKTEI MPEILSDTPI TTVKAISPNS KRVSPPHIGS SESGSILGKR  660
TNGRKLILRS IPAFPSLNPN Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1639651414120Protein lin-54 homolog
5fd3_B2e-1639651414120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1249263RRRCLDFEVLGKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018493471.10.0PREDICTED: CRC domain-containing protein TSO1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A078IU520.0A0A078IU52_BRANA; BnaCnng27630D protein
TrEMBLA0A0D3CH360.0A0A0D3CH36_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EKS80.0A0A3P6EKS8_BRAOL; Uncharacterized protein
STRINGBo5g094500.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]