PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2310_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 402aa    MW: 44579.2 Da    PI: 7.2361
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2310_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA927.6e-29150205158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVNaKQy++Il+RR++Rak+e e+k    +rkpylheSRhkhA+rR+R+sgGrF
  RrC2310_p3 150 QEPVYVNAKQYEGILRRRKARAKAELERKA--INRKPYLHESRHKHAMRRARASGGRF 205
                 69*************************999..89***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.1E-30148208IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.274149208IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-25151205IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.2E-23152174IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860154174IPR018362CCAAT-binding factor, conserved site
PRINTSPR006168.2E-23182205IPR001289Nuclear transcription factor Y subunit A
PfamPF118913.6E-15241312IPR021825Protein RETICULATA-related
CDDcd062571.77E-7359385IPR001623DnaJ domain
SuperFamilySSF465652.49E-8359386IPR001623DnaJ domain
Gene3DG3DSA:1.10.287.1101.1E-7360386IPR001623DnaJ domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MQSKSGGGNE EEVNQQQQQQ PMMMYPDPWW KNNSFGGGGV LPQETPPSNS NGESESNDVH  60
SPSEDDGPCK DSQAATSSPL VDNHGVEGND QQIVQPPELV GHYIACVPNP YQDAYYGGMM  120
GAYGHHQPLG FRPYLGMPRE RTALPLDVTQ EPVYVNAKQY EGILRRRKAR AKAELERKAI  180
NRKPYLHESR HKHAMRRARA SGGRFAKKTE AEAAEDAAEA AAAGRERERC SATNSSGSEQ  240
PTAAEYERRR EVFFNELQVV FADVVMAIIA DFMLVLPSCL LAPTVSLRPP FALSADGLSK  300
FFLNCPDNAF QGTDGLLQQP CCTTMKGEAV LMLEKYESSI KLCKQYNGFV LRLVRCTVPT  360
CSVSDIRKAY REAALKHHPD KAAGQSLTRK ETMEGDRRMK FT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-14150205258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189198RHKHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0258011e-118BT025801.1 Arabidopsis thaliana At5g12840 mRNA, complete cds.
GenBankAK3172991e-118AK317299.1 Arabidopsis thaliana AT5G12840 mRNA, complete cds, clone: RAFL21-66-A21.
GenBankY137201e-118Y13720.1 Arabidopsis thaliana mRNA for Hap2a transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399770.11e-124hypothetical protein EUTSA_v10014364mg
SwissprotQ9LXV51e-120NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLV4LN101e-124V4LN10_EUTSA; Uncharacterized protein
STRINGBra023378.1-P1e-123(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.35e-81nuclear factor Y, subunit A1