PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC22956_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 372aa    MW: 41248.2 Da    PI: 8.5996
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC22956_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.85.3e-17266300135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C+ Cgt kTplWR gp g+k+LCnaCG++  kk++
  RrC22956_p1 266 CVDCGTFKTPLWRGGPAGPKSLCNACGIKSGKKRQ 300
                  *****************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513755.7442659IPR002885Pentatricopeptide repeat
PROSITE profilePS513755.4816094IPR002885Pentatricopeptide repeat
PfamPF171779.8E-1786233IPR033443Pentacotripeptide-repeat region of PROPR
PROSITE profilePS513755.66795126IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.816141175IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.6E-7143177IPR002885Pentatricopeptide repeat
PROSITE profilePS5137512.529176210IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.0E-7178211IPR002885Pentatricopeptide repeat
PROSITE profilePS5137512.068211245IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007566.8E-9213247IPR002885Pentatricopeptide repeat
SuperFamilySSF577169.98E-12260300No hitNo description
PROSITE profilePS5011412.136260293IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-11260311IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.8E-14264298IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.90E-11265313No hitNo description
PfamPF003209.3E-15266300IPR000679Zinc finger, GATA-type
PROSITE patternPS003440266291IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MNLIGSWGKL GLAKYCNGIL AEMKPSTRLY NAVIDAFRCD DLVETCGIFD GFVRRGVKPG  60
FDGYLIVVQA LMNARRFSEG DCYVRRMCVE GIISSVYDYN AVIDCLYKAR RTKGDVKKVH  120
EETTYAFECF KEMLEWGIEP NEIMYNILIR SSCSVGDTGR SVKLFAEMKE KGLSPDVYAY  180
NAVIQGICRM RKVKKGEELF KTMLRVGLKP DNYTYTTLIK ALSECGRESE AREMFSLMER  240
HECVPDSSSS GSGGRGGSNG ETKRTCVDCG TFKTPLWRGG PAGPKSLCNA CGIKSGKKRQ  300
AALGIKPEKK IRKSNSSDSD LSLDHHRNDK NTDDDHRASS SSSNSSKRVS KLGEEERAAV  360
LLMALSCDSV YA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5i9g_C3e-36232528425pentatricopeptide repeat protein dPPR-U8C2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613067.11e-110PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial
SwissprotQ9LSQ21e-103PP239_ARATH; Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial
TrEMBLA0A078HB341e-111A0A078HB34_BRANA; BnaA01g27520D protein
STRINGBra021210.1-P1e-107(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49300.13e-25GATA transcription factor 16