PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2290_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 179aa    MW: 19391 Da    PI: 7.0967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2290_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.9e-39111101100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+l+r+C++ C++ap+f ++++ +fa vhk+FGasnv+kll+++pee+r+++++sl+yeA++r++dPvyG++g i +lq+++ +l++++a++++
  RrC2290_p4  11 SCAACKLLKRRCTPTCIFAPHFRSTDQMTFAKVHKVFGASNVSKLLSEVPEEQRQETVNSLAYEADVRLKDPVYGCIGAIASLQKKMLELQHDIAVARS 109
                 6*********************************************************************************************99987 PP

      DUF260 100 e 100
                 +
  RrC2290_p4 110 R 110
                 5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.52810111IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3811108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MRGHEPRSSS SCAACKLLKR RCTPTCIFAP HFRSTDQMTF AKVHKVFGAS NVSKLLSEVP  60
EEQRQETVNS LAYEADVRLK DPVYGCIGAI ASLQKKMLEL QHDIAVARSR LLSAHNNAGG  120
GGVNNNNNSN HVSSSPLVDD SSPQLAAFLD LVPSYSDLML LDGSGLDAYL FDIGQPPFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4061216121LOB family transfactor Ramosa2.1
5ly0_B3e-4061216121LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2546081e-126AC254608.1 Capsella rubella clone CAP16-D12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018488521.11e-109PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL86e-97LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A078F5A91e-102A0A078F5A9_BRANA; BnaA05g27870D protein
TrEMBLA0A397ZEE11e-102A0A397ZEE1_BRACM; Uncharacterized protein
STRINGBra034867.1-P1e-102(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.16e-82LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]