PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2280_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family BES1
Protein Properties Length: 277aa    MW: 30327.9 Da    PI: 8.4877
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2280_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222044.5e-6321361146
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslqssl 98 
                 ++++r+ptwkErEnnkrRERrRRaiaaki++GLR +Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp+ + ++ ++ s+sasp+ss+q   
  RrC2280_p1   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFTGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPMdRMEQRMNGSTSASPCSSYQ--- 97 
                 5899************************************************************************555667999***********... PP

      DUF822  99 kssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                      +sp+ sy++sp+sssfpsp++    +  +a+sl+p+l++ls+ 
  RrC2280_p1  98 -----PSPRGSYNPSPSSSSFPSPTN----PFGDANSLIPWLRNLSSN 136
                 .....*******************98....566678999999998763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.9E-603132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FTGLRIHGNF KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPMDRM EQRMNGSTSA SPCSSYQPSP RGSYNPSPSS SSFPSPTNPF  120
GDANSLIPWL RNLSSNSPSK LPFFHGNSIS APVTPPLARS PTYDQVTIPD SGWLSGMQTP  180
QSGPSSPTFS LVSRNPFFDK EAFKMGDCSS PMWTPGQSGN CSPAIPAGVD QNSDVPMADG  240
MAAEFAFGMV KPWEGERIHG ECVSDDLELT LGNSRTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737420.11e-172PREDICTED: BES1/BZR1 homolog protein 3
SwissprotO494041e-169BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLA0A078EC661e-171A0A078EC66_BRANA; BnaA03g43770D protein
STRINGBra012570.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-163BES1/BZR1 homolog 3