PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC22610_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 242aa    MW: 26363.9 Da    PI: 9.5191
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC22610_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.11.7e-39521511100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l++el +++
  RrC22610_p1  52 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISTLQHHIQSLQSELTTVR 149
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  RrC22610_p1 150 TE 151
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.22751152IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4052149IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MSRDREGFSE YHEIVKKVKK DPTFEKTADH AVMGIRRHVA MPPGTTLNTV TPCAACKLLR  60
RRCAEECPFS PYFSPHEPHK FAAVHKVFGA SNVSKMLLEV GESQRGDAAN SLVYEANLRL  120
RDPIYGCMGA ISTLQHHIQS LQSELTTVRT EILRHKYREA ATITSLQQNN NNNFNNNTTS  180
VSDHAALAAS ILLPPPPPPP PPPRPPRLLS SRPAAPPTPP ASLPSPSMVV SSSSSNSSAT  240
NS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-41451634122LOB family transfactor Ramosa2.1
5ly0_B2e-41451634122LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018433132.11e-134PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 13
SwissprotQ9AT611e-118LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0D3BTJ71e-126A0A0D3BTJ7_BRAOL; Uncharacterized protein
STRINGBo4g059520.11e-126(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-117LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]