PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC22257_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 86aa    MW: 9165.91 Da    PI: 9.4253
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC22257_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26067.43.3e-213280149
       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal 49
                 +CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll+ +
  RrC22257_p1 32 PCAACKILRRRCGEKCVLAPYFPPTEPAKFSIAHRVFGASNIIKLLQVA 80
                 7********************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.3223186IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-203279IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MLDMESKGDA SAAIIYASPA SSPPPPRVVL SPCAACKILR RRCGEKCVLA PYFPPTEPAK  60
FSIAHRVFGA SNIIKLLQVA NSLLLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-1731781057LOB family transfactor Ramosa2.1
5ly0_B2e-1731781057LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603026.13e-50PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR09e-32LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A078GDJ45e-49A0A078GDJ4_BRANA; BnaC08g43470D protein
TrEMBLA0A0D3DYI08e-49A0A0D3DYI0_BRAOL; Uncharacterized protein
TrEMBLA0A3P6FMJ18e-49A0A3P6FMJ1_BRAOL; Uncharacterized protein
STRINGBo8g112780.11e-49(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2065446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-32LOB domain-containing protein 1