PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2183_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 238aa    MW: 26864 Da    PI: 6.0558
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2183_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.51.8e-18169202134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 Cs+Cgt +Tp+WR gp g+ktLCnaCG+++++ +
  RrC2183_p3 169 CSHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGR 202
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.6E-7010238IPR016679Transcription factor, GATA, plant
SMARTSM004019.9E-16163213IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.13E-15166226No hitNo description
Gene3DG3DSA:3.30.50.105.4E-14167200IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.952167199IPR000679Zinc finger, GATA-type
CDDcd002025.51E-15168225No hitNo description
PROSITE patternPS003440169194IPR000679Zinc finger, GATA-type
PfamPF003204.2E-16169203IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MELWTEARAL KASLRGEAIK NQVSVSSEEL SRTSSAEDFS VECFLDFSEE VQEEEELVSV  60
TSSQEEHGQD CCIFSSQPCI FDQLPSLPDE YVEELEWVSR VVDDCSSPEV SLLFTQTHKT  120
KPSFSSSIPV KPRTKRSRSS VTGDRVWPRT GEQGRKKKQE TAVAFQRRCS HCGTNNTPQW  180
RTGPVGPKTL CNACGVRFKS GRLCPEYRPA DSPTFSTEIH SNLHRKVLEL RKSKELVE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527711e-130AK352771.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-P20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138318.11e-157PREDICTED: GATA transcription factor 3-like
RefseqXP_009138319.11e-157PREDICTED: GATA transcription factor 3-like
RefseqXP_009138320.11e-157PREDICTED: GATA transcription factor 3-like
RefseqXP_013724977.11e-157PREDICTED: GATA transcription factor 3-like
RefseqXP_013724978.11e-157PREDICTED: GATA transcription factor 3-like
SwissprotQ8L4M61e-126GATA3_ARATH; GATA transcription factor 3
TrEMBLA0A078I5Y41e-157A0A078I5Y4_BRANA; BnaA03g52990D protein
TrEMBLM4DMD71e-157M4DMD7_BRARP; Uncharacterized protein
STRINGBra017670.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57392647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.21e-118GATA transcription factor 3