PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC21462_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 260aa    MW: 28222.1 Da    PI: 9.4029
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC21462_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.84.9e-4052150199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+q+++l++el +++
  RrC21462_p1  52 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHQIQSLQSELTAVR 149
                  7*********************************************************************************************9988 PP

       DUF260  99 e 99 
                  +
  RrC21462_p1 150 T 150
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.14251152IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4052149IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MSRDREGFGD YYKIVKKVKK DPTFEKTMDH AVMGIRRHVA MPPGTTVNTV TPCAACKLLR  60
RRCAEECPFS PYFSPHEPQK FAAVHKVFGA SNVSKMLLEV GESQRGDAAN SLVYEANLRL  120
RDPIYGCMGA ISALQHQIQS LQSELTAVRT DILRHKYREA ATITSLQNNS FTSTTTTSVS  180
DHAALAAAIL SPPPLPPPNP PRPPRLLSSQ PAPPVSLSSP SMVVSSSNSS ATNSMYNLPP  240
SSAAGCSNSM STKNNVHYFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-43451634122LOB family transfactor Ramosa2.1
5ly0_B3e-43451634122LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018485161.11e-139PREDICTED: LOB domain-containing protein 13-like isoform X2
SwissprotQ9AT611e-124LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A397ZNW51e-137A0A397ZNW5_BRACM; Uncharacterized protein
STRINGBo4g059520.11e-126(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-102LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]