PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC212_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 368aa    MW: 42299.5 Da    PI: 6.5059
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC212_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.85.8e-23953145
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               kr e++ nrqvt+skR+ gilKKA+ELS+LCd+++ +++fs+tgk
  RrC212_p4  9 KRLESTGNRQVTYSKRKSGILKKAKELSILCDIDIVLLMFSPTGK 53
               6889****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-31160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.838161IPR002100Transcription factor, MADS-box
CDDcd002663.71E-28282No hitNo description
SuperFamilySSF554554.45E-27295IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-19323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-201257IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRVKLKIKR LESTGNRQVT YSKRKSGILK KAKELSILCD IDIVLLMFSP TGKPTVFHGE  60
HSCIEEVISK FAQLTPQERT KRKLESLEAL KKTFKKLDHD VNIHEFLGAR NQTIEGLSNQ  120
VAISQAQLME CHRRLSCWTN IDRIENTEHL NLLEDSLRKS IERIQFHKFH GGIQLPLPME  180
GNTSMQEAHS MSWLPNNDNQ ETILPGDPSF LPHREMDGLN PVYSNGFFES VKQEDQMCSN  240
QGQQFEQLEQ QQGNGCLGLQ QIGEEFSYPT PFGTTLGMEE DQEKKIKSEM ELNNLQQQQQ  300
QQQQQQQDPS SMYNPTANNG GCFQNPHDQS MFGTDHHHYH YQHHQNWVPG SVFGQASYNQ  360
VCVFLTFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A7e-14192190MEF2 CHIMERA
6byy_B7e-14192190MEF2 CHIMERA
6byy_C7e-14192190MEF2 CHIMERA
6byy_D7e-14192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1431720.0AY143172.1 Arabidopsis thaliana MADS-box protein AGL65 (AGL65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018448254.10.0PREDICTED: agamous-like MADS-box protein AGL65
SwissprotQ7X9I00.0AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A3P6G8500.0A0A3P6G850_BRAOL; Uncharacterized protein
STRINGBo8g068060.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.10.0AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]