PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC21122_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family G2-like
Protein Properties Length: 76aa    MW: 8746.43 Da    PI: 11.8157
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC21122_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.83.3e-301362251
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  RrC21122_p1 13 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 62
                 9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.2E-151063IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-261162IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-221363IPR006447Myb domain, plants
PfamPF002491.7E-71462IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MPRFPAKRSM RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH  60
LQLILITSPV SMYLTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292115e-66BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAB4934915e-66AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486895e-66AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013733842.12e-37PREDICTED: probable transcription factor KAN2 isoform X3
SwissprotQ9C6169e-39KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A078D4S81e-37A0A078D4S8_BRANA; BnaC08g07790D protein
TrEMBLA0A078DY603e-37A0A078DY60_BRANA; BnaA09g24470D protein
TrEMBLA0A0D3DKX39e-38A0A0D3DKX3_BRAOL; Uncharacterized protein
STRINGGSMUA_Achr2P18070_0019e-37(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-40G2-like family protein