PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC20782_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 309aa    MW: 34614.9 Da    PI: 4.5231
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC20782_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.2e-4351041100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kf +vhk+FGasnv+k+l++lp+ +reda++sl+yeAear+rdP+yG+vg+i+ lqq l++ +++l+++k
  RrC20782_p1   5 PCAACKLLRRKCTQECVFAPYFPPTQPQKFIYVHKVFGASNVTKILNDLPPPNREDAVNSLYYEAEARIRDPIYGCVGLISFLQQCLKKIQQDLVTAK 102
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  ee
  RrC20782_p1 103 EE 104
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381553.3E-1042307IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.7194105IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-415102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MASTPCAACK LLRRKCTQEC VFAPYFPPTQ PQKFIYVHKV FGASNVTKIL NDLPPPNRED  60
AVNSLYYEAE ARIRDPIYGC VGLISFLQQC LKKIQQDLVT AKEELAGYIG PDAVNPQQPY  120
LPPLANNPPP NFMMAMEGMP HGVVPQGEPL IIREPNMPQH QHQPQDEQMQ LMGTDAQRMA  180
AMILERGDHQ QEMFNGYGID NNGSVTATGY NQMDVNDHTA GGSLSGPSLA LGSFGDAYQM  240
GHETEHHISH DQLQTQLMLQ PPLQEGQEQN EGQFLMQPMG QENLHEEEDE EELEPPVKWR  300
KSDNKEASY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-4621088114LOB family transfactor Ramosa2.1
5ly0_B9e-4621088114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738350.0AB473835.1 Arabidopsis thaliana ASL2 mRNA for ASYMMETRIC LEAVES2-like 2 protein, complete cds.
GenBankAC0030400.0AC003040.3 Arabidopsis thaliana chromosome 2 clone F26B6 map CIC06C07, complete sequence.
GenBankAC0044820.0AC004482.3 Arabidopsis thaliana chromosome 2 clone F27L4 map CIC06C07, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018480301.10.0PREDICTED: LOB domain-containing protein 10
RefseqXP_018480302.10.0PREDICTED: LOB domain-containing protein 10
SwissprotO648361e-174LBD10_ARATH; LOB domain-containing protein 10
TrEMBLA0A0D3C1I70.0A0A0D3C1I7_BRAOL; Uncharacterized protein
TrEMBLA0A291LQY80.0A0A291LQY8_BRARR; Transcription factor LBD10
TrEMBLA0A397ZS710.0A0A397ZS71_BRACM; Uncharacterized protein
TrEMBLA0A3N6T4S20.0A0A3N6T4S2_BRACR; Uncharacterized protein
TrEMBLA0A3P6CBS80.0A0A3P6CBS8_BRAOL; Uncharacterized protein
TrEMBLM4ETM10.0M4ETM1_BRARP; Uncharacterized protein
STRINGBra032153.1-P0.0(Brassica rapa)
STRINGBo4g151770.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149081720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.21e-140LOB domain-containing protein 10
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]