PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC19886_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 157aa    MW: 18405.2 Da    PI: 5.8744
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC19886_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26046.21.3e-1425052100
       DUF260  52 eeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  e+r +a+ +++yeA+ar++dP+yG+v++i++lq+q+ +l+++l+ lk++
  RrC19886_p1   2 EDRCEAAITIYYEAQARLQDPIYGCVSHIFSLQRQVVNLQSQLEILKQQ 50 
                  67999****************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.079151IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-12248IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MEDRCEAAIT IYYEAQARLQ DPIYGCVSHI FSLQRQVVNL QSQLEILKQQ ATQSMMASDT  60
PSIEDPSYYR DTKLQQLQQS LDLHRHHNNH HQDRSSETEF NSDLKDIVTS YSELDQHLNT  120
FNQHHNHARI FCQRVSGTSR IRDDFGEDVI EHILHIN
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:15659631}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018481545.12e-81PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 17-like
SwissprotQ9SLB68e-44LBD17_ARATH; LOB domain-containing protein 17
TrEMBLA0A078IAR07e-66A0A078IAR0_BRANA; BnaA04g24480D protein
STRINGBra016876.1-P8e-66(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM10828359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42440.13e-46LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]