PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC19294_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 189aa    MW: 21855.2 Da    PI: 8.6769
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC19294_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.25.7e-151152344
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 i +k+ r +tf kR++g +KK +EL +LC+++++ +++s ++
  RrC19294_p1 11 IPDKTSRRTTFKKRKAGFMKKLNELVTLCGVKACAVVYSDQN 52
                 7899***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.694161IPR002100Transcription factor, MADS-box
SMARTSM004325.5E-16161IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-8323IPR002100Transcription factor, MADS-box
CDDcd002661.51E-26384No hitNo description
SuperFamilySSF554556.41E-21396IPR002100Transcription factor, MADS-box
PfamPF003199.3E-161152IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MVRSRVKLSL IPDKTSRRTT FKKRKAGFMK KLNELVTLCG VKACAVVYSD QNDANPEAWP  60
SRAEAGEVIS KFMEFPEVER DKKMYDQKRY TLERISKEQA TLQRLQEENR EFELKEIMFN  120
LIKGKRMMQH HSNDASFLYD LTKFIDFNVS ELTKRIHLLQ ANGEPISFLP LDDGDVDAAH  180
PAVGDMLLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018482569.11e-134PREDICTED: agamous-like MADS-box protein AGL86
TrEMBLM4D0B39e-99M4D0B3_BRARP; Uncharacterized protein
STRINGBra009911.1-P2e-99(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.16e-42AGAMOUS-like 38