PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1855_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TCP
Protein Properties Length: 338aa    MW: 38062.1 Da    PI: 6.3945
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1855_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP109.16.5e-3426108183
         TCP   1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                 a+g+kdrhsk+ T++g+RdRRvRl a++a++f+d+qd+L +d++sk+++WL+++ak+ai++l  t+ + ++ ++++ssss+ +
  RrC1855_p1  26 ATGRKDRHSKVFTSKGPRDRRVRLAAHTAIQFYDVQDRLQYDRPSKAVDWLIKKAKAAIDKLETTQEPENTTTKPGSSSSEPN 108
                 589**************************************************************555554444444444333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-3027134IPR005333Transcription factor, TCP
PROSITE profilePS5136930.3462987IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGLKGYSAGD EVGEIIEVPG GHIIRATGRK DRHSKVFTSK GPRDRRVRLA AHTAIQFYDV  60
QDRLQYDRPS KAVDWLIKKA KAAIDKLETT QEPENTTTKP GSSSSEPNLV DTQTQFVAAN  120
LDPEEAMKTF FPATTSGGGT NMNFQNYPHH HDTDNIVSRT TTTTPNLSQD LGLSLHPFQG  180
NNISNTVVPE TNNFATAHFE TFGRISGWNN HDLTMTSSSS PSEQQQEQER GNGGFMVNLH  240
HHQPSMMTLL NSQQQQVFLG GQQQQRVWFS WDDDDARPQL PHPWRRIYST KLLFFSSSKL  300
TPLNAEKGVF LISYDAEQKG GINEMEEEYA IYLSFYHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-203487154Putative transcription factor PCF6
5zkt_B4e-203487154Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018434158.10.0PREDICTED: transcription factor TCP10
SwissprotO822771e-111TCP10_ARATH; Transcription factor TCP10
TrEMBLA0A0D3BTA81e-173A0A0D3BTA8_BRAOL; Uncharacterized protein
STRINGBo4g053680.11e-174(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141581924
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31070.11e-108TCP domain protein 10
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  2. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]