PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC17912_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 132aa    MW: 14633.5 Da    PI: 8.4818
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC17912_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.81.9e-4312110199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cv+apyfp ++p kfanvh++FGasnv+k+l+++ +++red+++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el++++
  RrC17912_p1  12 PCAACKFLRRRCTSGCVFAPYFPPDEPTKFANVHRIFGASNVSKILHEVAPHQREDTVNSLAYEAEARLNDPVYGCVGAISVLQRQVLKLQRELEETN 109
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  RrC17912_p1 110 A 110
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.73811112IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-4312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MASSHSNYIN SPCAACKFLR RRCTSGCVFA PYFPPDEPTK FANVHRIFGA SNVSKILHEV  60
APHQREDTVN SLAYEAEARL NDPVYGCVGA ISVLQRQVLK LQRELEETNA DLRRYARALG  120
GETTSNYGGQ RG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-58101259125LOB family transfactor Ramosa2.1
5ly0_B3e-58101259125LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018439419.12e-95PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q31e-82LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A0D3AW942e-89A0A0D3AW94_BRAOL; Uncharacterized protein
TrEMBLA0A3N6T5412e-89A0A3N6T541_BRACR; Uncharacterized protein
TrEMBLA0A3P6DS912e-89A0A3P6DS91_BRAOL; Uncharacterized protein
STRINGBo2g144870.13e-90(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-85LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]