PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1774_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 434aa    MW: 47257.4 Da    PI: 7.682
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1774_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.22.2e-25135191259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +Dgy+WrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+++g+H he
  RrC1774_p3 135 RDGYHWRKYGQKQVKSPKGSRSYYRCTHSDCCAKK-IECSNDSGNVIEIVNKGSHSHE 191
                 7********************************98.*********************8 PP

2WRKY94.95.6e-30298354359
                 -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 Dgy+WrKYGqK+vkg+ +pr+YYrCtsagC+v+k++e++ ++ ++v+itY+g Hnh+
  RrC1774_p3 298 DGYRWRKYGQKMVKGNLNPRNYYRCTSAGCTVRKHIETAVDNRTAVVITYKGVHNHD 354
                 9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.5E-20131192IPR003657WRKY domain
SuperFamilySSF1182901.83E-19132191IPR003657WRKY domain
SMARTSM007746.3E-23134192IPR003657WRKY domain
PROSITE profilePS5081115.193136193IPR003657WRKY domain
PfamPF031063.4E-17136190IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-30281356IPR003657WRKY domain
PROSITE profilePS5081130.503291356IPR003657WRKY domain
SuperFamilySSF1182903.66E-26292356IPR003657WRKY domain
SMARTSM007744.8E-33296355IPR003657WRKY domain
PfamPF031061.7E-22298354IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MEDKGSDEAD VYAATETEMT EKVEPEKELC HGDDDDELSQ RRSEESVTDM EGIQVRETLA  60
KDHDEGGARE NSSVEPNRED AKEKASGTVD TSISSNPSAA HGVSLVSVPS KQEQRSGSRV  120
VSNLSVSPVL RTPARDGYHW RKYGQKQVKS PKGSRSYYRC THSDCCAKKI ECSNDSGNVI  180
EIVNKGSHSH EPLRNNSFSP RETRAAAPVI SPVTEDNTGV RSCSALSAST KENICESSLA  240
VVGGKRNCEN EAMEEPEPKR RQVLLKKGNS QSSDSASKLG KKQRFVVHAA GDVGISGDGY  300
RWRKYGQKMV KGNLNPRNYY RCTSAGCTVR KHIETAVDNR TAVVITYKGV HNHDMPVPKK  360
RHGPPSSELV AAVAPTSMRT RSEDQVNIPT SGQCSVRGGS EKQSSEAVDV VGGEKVVMES  420
ARTLLSIGFE IKQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A8e-24287356877Probable WRKY transcription factor 4
1wj2_A8e-24287356877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300490.0KF430049.1 Brassica rapa WRKY transcription factor 32 (WRKY32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108959.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0A7RI760.0A0A0A7RI76_BRAOC; WRKY35 protein
STRINGBra010266.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32