PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC156_p5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family VOZ
Protein Properties Length: 706aa    MW: 79032 Da    PI: 6.8382
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC156_p5genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ415.11.2e-1272234362215
        VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsll 101
                ppsaflgpkcalwdctrpa+gs+w+ dycs +h +lalne++pgt+pvlrp+gi+lkd+ll++al+ak+ gk+vgip+cega+++k+pwnaaelf+l+l+
  RrC156_p5 223 PPSAFLGPKCALWDCTRPAHGSDWYMDYCSDYHGNLALNEDSPGTAPVLRPGGISLKDNLLIDALRAKTLGKNVGIPVCEGAVNTKCPWNAAELFHLELV 322
                7*************************************************************************************************** PP

        VOZ 102 egetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvs 201
                egetirewlffdkprra++sgnrkqrslpdy+grgwhesrkq+mke++g+krsyymdpqp++ fewhl+ey+ine+da+alyrlelkl+++kks+kg+v+
  RrC156_p5 323 EGETIREWLFFDKPRRAYDSGNRKQRSLPDYNGRGWHESRKQLMKEQEGQKRSYYMDPQPPGPFEWHLFEYQINESDACALYRLELKLTNGKKSPKGRVA 422
                **************************************************************************************************** PP

        VOZ 202 kdsladlqkklgrl 215
                kd+ladlqkk+ ++
  RrC156_p5 423 KDPLADLQKKMEKM 436
                ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF129996.6E-29510615IPR028146Glucosidase II beta subunit, N-terminal
Gene3DG3DSA:4.10.400.105.9E-4535575IPR002172Low-density lipoprotein (LDL) receptor class A repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MSNYPKMTCV SSSHQNLMEK LMQLQERFSH LQAARREGRL NDHALLEAQI SQNLREWQAE  60
LSAPSPESSL LGGSISQFSE EIARLLKLND EEDDATSTLK EHAAPPKPDA FDQSLCSPGH  120
LEWTAEPFDQ TSFDVNFLSG FEDDVNNSET HGQQLHCAFQ EFDPSINTAP DFHAQKLSHL  180
DITSQLDYHL SEVRQEFNNT PSSVKLDVSD ESEFTTPSSV RVPPSAFLGP KCALWDCTRP  240
AHGSDWYMDY CSDYHGNLAL NEDSPGTAPV LRPGGISLKD NLLIDALRAK TLGKNVGIPV  300
CEGAVNTKCP WNAAELFHLE LVEGETIREW LFFDKPRRAY DSGNRKQRSL PDYNGRGWHE  360
SRKQLMKEQE GQKRSYYMDP QPPGPFEWHL FEYQINESDA CALYRLELKL TNGKKSPKGR  420
VAKDPLADLQ KKMEKMGQLT PEVASDKPSP PTKSRAKAAK GVKAATGNLT QETTVPATAA  480
STFSKAALAN MSRNNIKLLQ CVSSFLFAVV SVNCSTTPLV GVHPLDEKYF ESDIIRCKDG  540
SKSFPRDRLN DNFCDCLDGT DEPGTSACPN GKFYCRNTGS SPKFVYSSRV NDRICDCCDG  600
SDEYESSITC PNTCIMGGNV NYVYKPRTYR KSIDRQLGSV TTDPNRSLTI ANLQDIVKNL  660
QGMKLVFAVQ MVLIGFLVIL WMLRRRARSS KRRRYLLKSV HPNRSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f0e_B1e-29529614287Glucosidase 2 subunit beta
5h9o_B1e-29529614287Glucosidase 2 subunit beta
5h9o_D1e-29529614287Glucosidase 2 subunit beta
5ied_B1e-29529614287Glucosidase 2 subunit beta
5iee_B1e-29529614287Glucosidase 2 subunit beta
5ief_B1e-29529614287Glucosidase 2 subunit beta
5ieg_B1e-29529614287Glucosidase 2 subunit beta
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1682688LRRRARS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00018PBMTransfer from AT2G42400Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1252570.0AB125257.1 Arabidopsis thaliana AtVOZ2 mRNA for Transcription factor AtVOZ2, complete cds.
GenBankAF3618310.0AF361831.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
GenBankAY0780480.0AY078048.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018433046.10.0PREDICTED: transcription factor VOZ2
RefseqXP_018433047.10.0PREDICTED: transcription factor VOZ2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLA0A078JFQ30.0A0A078JFQ3_BRANA; BnaC04g52750D protein
STRINGBo4g015980.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]