PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1555_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Nin-like
Protein Properties Length: 491aa    MW: 54867.3 Da    PI: 7.1245
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1555_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK94.66.7e-30222273152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  RrC1555_p2 222 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 273
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2210293IPR003035RWP-RK domain
PfamPF020426.6E-26225273IPR003035RWP-RK domain
SuperFamilySSF542772.7E-22383479No hitNo description
SMARTSM006664.7E-24393476IPR000270PB1 domain
PROSITE profilePS5174527.257393476IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-19394473No hitNo description
PfamPF005644.3E-18394474IPR000270PB1 domain
CDDcd064071.59E-36394470No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MSCLKQSKTG CRHNDHNYIH CVSTIDDACY VGDPTVREFH EACSEHHLLK GQGVVGEAFL  60
TNGPCFSSDV SSYKKSEYPL SHHATMFGLH GTVAIRLRCI HTGSADFVLE FFLPKDCRDI  120
EEQRRMLNAL STIMAHVPRS LRTVTDKELE EEGDSTVETV PKTESTCEVH ESNSNNPQGV  180
GGTSEMGELG FDYGKGVSVN ENSTFSSGGG SSRVTERKKT KAEKNITLDV LRQYFAGSLK  240
DAAKSIGVCP TTLKRICRQH GIQRWPSRKI KKVGHSLQKI QRVIDSVQGV SGHHLPIGSF  300
YANFPNLASS QEASSSQQQQ SKQTTFLPSS HSQPAKSPGS SCSHTSSCSS ETQVNKEEPM  360
NKAREDAMTL SRSFKETQTT QLSPSTSSQD DDFLRIKVSY EEEKIRFRMR NSRRLKDLLW  420
EIAKRFSIEE VSRYDLKYLD EDNEWVLLRC DDDVEECVDV CRSFPGQTIK LLLQLSSQHL  480
QERSSVSGSL S
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018445394.10.0PREDICTED: protein NLP5
RefseqXP_018445395.10.0PREDICTED: protein NLP5
RefseqXP_018445396.10.0PREDICTED: protein NLP5
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLA0A1J3J0Y00.0A0A1J3J0Y0_NOCCA; Protein NLP5 (Fragment)
TrEMBLV4KCL80.0V4KCL8_EUTSA; Uncharacterized protein
STRINGXP_006390206.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein