PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC152_p8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family BES1
Protein Properties Length: 276aa    MW: 30140.8 Da    PI: 8.4915
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC152_p8genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822203.56.3e-6321351146
     DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                ++++r+ twkErEnnkrRERrRRaiaaki+aGLR +Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp++++e ++ s+sasp+ss+q     
  RrC152_p8   2 TSGTRTLTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPMDRMELMNGSTSASPCSSYQ----- 96 
                5899*******************************************************************************************..... PP

     DUF822 101 salaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                   +sp+ sy+ sp+sssfpsp+++      +a+sl+p+l++ls+ 
  RrC152_p8  97 ---PSPRGSYNLSPSSSSFPSPTNI----FGDANSLIPWLKNLSSN 135
                ...*******************994....34567899999999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.4E-594132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MTSGTRTLTW KERENNKRRE RRRRAIAAKI FAGLRIHGNF KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPMDRM ELMNGSTSAS PCSSYQPSPR GSYNLSPSSS SFPSPTNIFG  120
DANSLIPWLK NLSSNSPSKL PFFHGNSISA PVTPPLARSP TRDQVTIPES GWLSGMQTPQ  180
SGPSSPTFSL VSRNPFFDKE AFKMGDCSSP MWTPGQSGNC SPAIPAGVDQ TSDVPMADGM  240
AAEFAFGMVK PWEGERIHGE CVSDDLELTL GNSRTR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00444DAPTransfer from AT4G18890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013726912.11e-175PREDICTED: BES1/BZR1 homolog protein 3-like
SwissprotO494041e-170BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLA0A078CUP91e-175A0A078CUP9_BRANA; BnaA01g09700D protein
TrEMBLM4DA491e-175M4DA49_BRARP; Uncharacterized protein
STRINGBra013359.1-P1e-174(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-151BES1/BZR1 homolog 3