PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC15100_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 228aa    MW: 24951.4 Da    PI: 8.3645
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC15100_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.61.4e-40461451100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p kfa vhk+FGasnv+k+l ++pe +r da++slvyeA++r+rdPvyG++g i +lqqq++ l+ael +++
  RrC15100_p1  46 PCAACKLLRRRCAQECPFSPYFSPHEPLKFASVHKVFGASNVSKMLMEVPEGHRADAANSLVYEANVRLRDPVYGCMGAIVALQQQVQALQAELTAVR 143
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  RrC15100_p1 144 SE 145
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.87845146IPR004883Lateral organ boundaries, LOB
PfamPF031959.1E-4146143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MQRERERLES EIGKKNKREA DALPHQMAGI RRPISGPLGA LNTITPCAAC KLLRRRCAQE  60
CPFSPYFSPH EPLKFASVHK VFGASNVSKM LMEVPEGHRA DAANSLVYEA NVRLRDPVYG  120
CMGAIVALQQ QVQALQAELT AVRSEILKYK QREAVATLIV PSNSQVAGYH NSGDVSVIAP  180
TPQTPSTPPQ RTAAHPDPPP PSSCVYSQPT TRALEYGEIE SENNSYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-414614911114LOB family transfactor Ramosa2.1
5ly0_B2e-414614911114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141907.11e-129PREDICTED: LOB domain-containing protein 15 isoform X2
SwissprotQ8L5T51e-120LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A087H4761e-135A0A087H476_ARAAL; Uncharacterized protein
STRINGA0A087H4761e-136(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-115LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]