PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1508_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 121aa    MW: 13608.9 Da    PI: 9.131
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1508_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.75.3e-4051051101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+C+kdC+++pyfp ++p kfa++h+++Ga nv+k+l++lp ++r +a++sl +eA++r++dPvyG+vg+i+ lq q++++++ la++++
  RrC1508_p2   5 RCAACKYLRRRCPKDCIFSPYFPPSDPDKFACIHRIYGAGNVSKMLQQLPVQTRAEAVESLSFEAKCRVEDPVYGCVGIISLLQTQIQKTQTLLARTQA 103
                 6*********************************************************************************************99998 PP

      DUF260 100 el 101
                 ++
  RrC1508_p2 104 QI 105
                 75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.7264105IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-395102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MNPKRCAACK YLRRRCPKDC IFSPYFPPSD PDKFACIHRI YGAGNVSKML QQLPVQTRAE  60
AVESLSFEAK CRVEDPVYGC VGIISLLQTQ IQKTQTLLAR TQAQIAVAQA KHSQTQISEF  120
M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-37610512111LOB family transfactor Ramosa2.1
5ly0_B1e-37610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738471e-116AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds.
GenBankDQ0566091e-116DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018483059.16e-86PREDICTED: LOB domain-containing protein 23
SwissprotP594675e-75LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A078FKY42e-82A0A078FKY4_BRANA; BnaA06g32760D protein
TrEMBLA0A291LR062e-82A0A291LR06_BRARR; Transcription factor LBD24
TrEMBLA0A397ZCU92e-82A0A397ZCU9_BRACM; Uncharacterized protein
STRINGBo7g083780.12e-78(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.12e-66LOB domain-containing protein 23