PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1484_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GeBP
Protein Properties Length: 403aa    MW: 44027.4 Da    PI: 5.2542
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1484_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573123.31.2e-38149244297
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                 +fqr+wseeDei+ LqGlid++++tg+sp+dd++afy +vkksisf+vsk+ql++K+  LK K++++  k k+g+e++fsk+hd+k+f+lsk +Wg
  RrC1484_p2 149 YFQRVWSEEDEIAALQGLIDYRDETGASPYDDTNAFYLYVKKSISFDVSKTQLLKKLWGLKTKYENNLGKEKNGEEVTFSKPHDRKAFDLSKLFWG 244
                 79*********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.4E-33150244IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MSKKRFNPLE DPPNASSSDE DNDEMEEAGN SSSEEETDDE SSLKKPESAA PEKNHQPSDS  60
GSGSGSDEET DSDSQTERKN SSAVKSITGT KDSAVVVVKK NHDSDKKVKP LTKCSTKKRS  120
LSDTDGAAAE AKKAKTGSGT GEESAKKSYF QRVWSEEDEI AALQGLIDYR DETGASPYDD  180
TNAFYLYVKK SISFDVSKTQ LLKKLWGLKT KYENNLGKEK NGEEVTFSKP HDRKAFDLSK  240
LFWGGDGVAL DSAVKSNGKK SKKSSKTKVE EAEKVALDSA NGKSKKSSKS KVEAEKKELA  300
SSSSPNGKSC EDEVVTNKGG EASGVVAEVD AFEKSGLVKA LARFGVDDIT AQQGWSRLAL  360
EDKKRFEEEW KVLQLRELEF YSQKSGFIHE VVTKMAESFQ PNP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638352.11e-178PREDICTED: mediator-associated protein 1
TrEMBLA0A0D3C9B91e-178A0A0D3C9B9_BRAOL; Uncharacterized protein
STRINGBra019847.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.13e-55DNA-binding storekeeper protein-related transcriptional regulator