PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC14313_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 344aa    MW: 38182.9 Da    PI: 8.2592
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC14313_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.68.9e-33182237258
    CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  ep++VNaKQy++I++RRq+Rakle+++kl +k+rkpylheSRh hAl+RpRgsgGrF
  RrC14313_p1 182 EPVFVNAKQYHAIMRRRQQRAKLEAQNKL-IKARKPYLHESRHVHALKRPRGSGGRF 237
                  9****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-38179240IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.879180240IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.4E-27182237IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.0E-24183205IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860185205IPR018362CCAAT-binding factor, conserved site
PRINTSPR006169.0E-24214237IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MVELCRYSSC EDSLLGVMYQ MNKKDSTLPY LNTSISWGCM IPTEPLGLKV GDARPEHMQT  60
TKKISFQDLD SPSSQSTDQS YSEVVSSGDD KPCRQISFST KSGSEETQQK GFATHPNLAS  120
MTGVSSIHFT PPQANFSFHY ADPHIGGLLA ATYLPQGPTC NPQMVGMVPG RVPLPVEITE  180
TEPVFVNAKQ YHAIMRRRQQ RAKLEAQNKL IKARKPYLHE SRHVHALKRP RGSGGRFLNT  240
KQLLQESELA TAKEQEHNKT VQQENKKANM SRFEAHMLQH SKDRGSTTSG SDITSVSDGA  300
DIFGHTEFQF SGFPTTQTNR AILVHGQSND MHGGGDLHHF SVHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20182242363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591675.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
SwissprotQ93ZH20.0NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A078JS780.0A0A078JS78_BRANA; BnaCnng68450D protein (Fragment)
STRINGBra003867.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.10.0nuclear factor Y, subunit A3