PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC13986_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 196aa    MW: 22232.2 Da    PI: 9.8658
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC13986_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA80.62.8e-25124173151
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRp 51 
                  +ep++VNaKQy++Il RR++Rakle+++kl +ksrkpylheSRh hAl+R+
  RrC13986_p2 124 NEPMFVNAKQYHAILCRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRA 173
                  59****************************.*******************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-24122179IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115226.682123183IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.9E-20125173IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-14126148IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-14157180IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MPTNSNIQGS QSFSLTKDMM MMSTRSGLQL QDQDSSSMQS TGESSGGCEA ASFGEHTSIS  60
SYIKNQGKAI ESYTTTSSMV SRDSVSPPPA SGLASWPPQC PDETPHFNVF FCLQVPLPHN  120
IQENEPMFVN AKQYHAILCR RKHRAKLEAQ NKLIKSRKPY LHESRHLHAL KRALRWAFPQ  180
YKEASRTIKL TLWWWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-15124172250NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0814451e-72AY081445.1 Arabidopsis thaliana unknown protein (At1g54160) mRNA, complete cds.
GenBankAF3869571e-72AF386957.1 Arabidopsis thaliana Unknown protein (F15I1.26) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622821.12e-90PREDICTED: nuclear transcription factor Y subunit A-5-like
SwissprotQ9SYH43e-75NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A078J0R84e-93A0A078J0R8_BRANA; BnaCnng30790D protein
STRINGAT1G54160.17e-73(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-63nuclear factor Y, subunit A5