PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC13731_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 322aa    MW: 35768.8 Da    PI: 7.021
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC13731_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.42.1e-4271061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp ++p+kf +vhk+FGasnv kll+++  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++ +ql+++l+ +k
  RrC13731_p1   7 PCAACKFLRRKCTQECVFAPYFPPDNPQKFSYVHKVFGASNVAKLLNEIAANQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRHKQLQQDLENAK 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  RrC13731_p1 105 KE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381552.8E-924319IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.4366107IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MASSSSPCAA CKFLRRKCTQ ECVFAPYFPP DNPQKFSYVH KVFGASNVAK LLNEIAANQR  60
EDAVNSLFYE AEARLRDPVY GCVGLISILQ HRHKQLQQDL ENAKKELAAY VGPQAMLPIL  120
QTQHHPQPHF MSLSPQPQPQ PSSSSSASVL THQHHNLFPM MAIPTGQLYH QQQIFEAQQL  180
AVAREQQQNE LFRAFGAGGG SNTSPHNHQN QPQVEVLRFD NSFDFVPTGS VTVTGFNQLS  240
SRGTTVTGMS SSLALGGNFV DSPPTNDSYH TDQQLHHHQK QQHHEAQLFI PTQSSQPLPL  300
QTQETQTQPN SESEEGRRSI IG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4731107114LOB family transfactor Ramosa2.1
5ly0_B2e-4731107114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018439148.10.0PREDICTED: LOB domain-containing protein 36
RefseqXP_018439149.10.0PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ31e-152LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A3P6AVY70.0A0A3P6AVY7_BRACM; Uncharacterized protein
STRINGBra012112.1-P0.0(Brassica rapa)
STRINGBo7g064360.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-134ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]