PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1346_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 172aa    MW: 18692.1 Da    PI: 7.7891
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1346_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.31.5e-44131121100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca+dCv++pyfpa++p+kfanvh++FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+ +lal+++
  RrC1346_p3  13 PCAACKLLRRRCAQDCVFSPYFPADEPQKFANVHRVFGASNVNKMLQELPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQGQLALAQA 111
                 7**********************************************************************************************9997 PP

      DUF260 100 e 100
                 e
  RrC1346_p3 112 E 112
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.09612113IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKESSRKQGA ASPCAACKLL RRRCAQDCVF SPYFPADEPQ KFANVHRVFG ASNVNKMLQE  60
LPIHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID VLQGQLALAQ AEVVHLRVRH  120
STNFPGHGLC PDSPSSSGSP SSKQVSPQDN KGIFSHMDMV DEASLGESMW SC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-5091147112LOB family transfactor Ramosa2.1
5ly0_B8e-5091147112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738391e-173AB473839.1 Arabidopsis thaliana ASL6 mRNA for ASYMMETRIC LEAVES2-like 6 protein, complete cds.
GenBankBT0150671e-173BT015067.1 Arabidopsis thaliana At1g31320 gene, complete cds.
GenBankBT0156651e-173BT015665.1 Arabidopsis thaliana At1g31320 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018486923.11e-126PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE91e-106LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A078INQ11e-124A0A078INQ1_BRANA; BnaCnng19520D protein
TrEMBLA0A0D3D5L91e-124A0A0D3D5L9_BRAOL; Uncharacterized protein
TrEMBLA0A291LQV01e-124A0A291LQV0_BRARR; Transcription factor LBD4
TrEMBLA0A397YJZ41e-124A0A397YJZ4_BRACM; Uncharacterized protein
TrEMBLA0A3P6EJ491e-124A0A3P6EJ49_BRAOL; Uncharacterized protein
TrEMBLM4DEI61e-124M4DEI6_BRARP; Uncharacterized protein
STRINGBra014907.1-P1e-124(Brassica rapa)
STRINGBo7g041000.11e-124(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-103LOB domain-containing protein 4