PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC12859_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 570aa    MW: 62139 Da    PI: 8.2758
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC12859_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.7e-16288326240
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+CnCk+skClk+YCeCfaag++C   C+C dC+Nk 
  RrC12859_p1 288 SCKRCNCKRSKCLKLYCECFAAGVYCIGPCSCVDCFNKP 326
                  689**********************************96 PP

2TCR51.61.8e-16374413140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN  
  RrC12859_p1 374 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNAF 413
                  589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.3E-18287328IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.562288414IPR005172CRC domain
PfamPF036389.7E-12290325IPR005172CRC domain
SMARTSM011149.9E-17374415IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.2E-12376412IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MDTPKKTVTQ SENPVSKLKL ENSPVYNYIN SLTPIKPVRS LTFPQTIGSL SYSSPPSVFT  60
SPHASSHKGS RFNSDDTNSS KDVPASVGEE ALHETEPPQI QQNECTTITT TPPRVINDNE  120
TDLLKMCDGN VKQKSETPDW NAIISGYDDL LICDPNNESE ASRCFLGRST ESKARLLSVT  180
KPSDDALHRG VTKRCLDFEM PGNNKHMSVE SSPRCVVANI GLHLSTIAVS SKDNNVGNDY  240
SLSGHSKVDL QGSISAVHNS QETVKDNGQG LKEGAMRKVE QAGEVESSCK RCNCKRSKCL  300
KLYCECFAAG VYCIGPCSCV DCFNKPIHED TVMATRKQIE SRNPLAFAPK VIGNSDSVVE  360
IGDGNASKTP ASARHKRGCN CKKSNCLKKY CECYQSGVGC SINCRCEGCK NAFGKKYVSA  420
GSSFTGMHVK QDKENETSER GRTEKQPSTP MPLRQPLAHL PISSNNILLP HQHLHGASGS  480
SLLKSQSFKR QDMSLLSHSN IETITEKRAD DIENLIQSPI TNMINNAVTP NSKRVSLPHV  540
GSSELSPCRR NGGRKLLLSV PTFPSLSPHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1729041112120Protein lin-54 homolog
5fd3_B1e-1729041112120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584927.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
RefseqXP_013695714.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A0D3CH370.0A0A0D3CH37_BRAOL; Uncharacterized protein
STRINGBo5g094510.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]