PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1271_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 495aa    MW: 53487.5 Da    PI: 8.4535
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1271_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.41.6e-1473112141
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                 ++kk+CnCk+s+Clk+YCeCfa g++C+  C+C +C+N+ +
  RrC1271_p2  73 QKKKHCNCKHSRCLKLYCECFATGTYCDG-CNCVNCFNNVD 112
                 589**************************.********976 PP

2TCR51.42.1e-16153191139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 k++kgCnCkks ClkkYCeCf+a+  Cse+CkC dCkN 
  RrC1271_p2 153 KHNKGCNCKKSGCLKKYCECFQANILCSENCKCLDCKNF 191
                 589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.1E-1673113IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.09474193IPR005172CRC domain
PfamPF036387.1E-1175110IPR005172CRC domain
SMARTSM011147.5E-19153194IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.4E-13156191IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MPARQLHFTG GSDQQHSLSK PAPTAAKPLV APSVPSPVTV TPTTTTMTSR LHPVESPISR  60
QKPIVEGRDG TPQKKKHCNC KHSRCLKLYC ECFATGTYCD GCNCVNCFNN VDKETARRDA  120
VEAILERNPN AFRPKIASSP RGVRDKREEM LGKHNKGCNC KKSGCLKKYC ECFQANILCS  180
ENCKCLDCKN FDGSEERQAL FHGEHANNMA YLQQAANAAI TGAVGSSGFA PSPASKRRKG  240
GQDISFNQAT KDTSSPAAPS KFAYRSLLAD DVKALCSVLV AVAGEAAKTL TGETLNKRNA  300
NRVEDQTETS LASAAQENSQ GDVEMAEADK SGEEGSNLDA SKGKPLSPAT LALMCDDEQD  360
TIFMVAASEP NGSMDPGGCR TNSQWQSQNY AEQERAVLLF HLLHILLIVA TFFSKVSKVK  420
SKCLYLARRH IQSPPTATTT VKTENGVQQV PPIVNGTTTQ PTVNKPQLLQ PMTATNTSST  480
HHPHKPPALP EKKDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-337520211132Protein lin-54 homolog
5fd3_B4e-337520211132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186581e-142AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059311e-142BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596271.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_013705473.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A3P6F4W30.0A0A3P6F4W3_BRAOL; Uncharacterized protein
STRINGBo7g113450.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein