PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC12373_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 189aa    MW: 21427.8 Da    PI: 9.3865
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC12373_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.8e-4161136277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv++C+++l++ak+y+rrhkvCevh+ka++++v+g ++rfCqqCsrfhel efDe+krsCrrrLa+hnerrrk +
  RrC12373_p1  61 CQVDRCTSNLTDAKQYYRRHKVCEVHAKASAATVAGAKRRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKIS 136
                  *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3156122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.13758135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.5E-3760137IPR004333Transcription factor, SBP-box
PfamPF031107.7E-3161134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MERSQGWSYV KDKAIVSNHA EQEWENGMDE EEEDGGDEDK RKGVMERARG TNTDRGPSRL  60
CQVDRCTSNL TDAKQYYRRH KVCEVHAKAS AATVAGAKRR FCQQCSRFHE LPEFDEAKRS  120
CRRRLAGHNE RRRKISGDGC GEGAGRRGLS GQLIQTQERN RVDMKLPMTN SSFKRPQIRS  180
IGGQSGDPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3859134984squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0037141e-173BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds.
GenBankAK1186111e-173AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBankAJ2429601e-173AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBankAJ0116101e-173AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675932.11e-109PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7587e-98SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A078G6791e-108A0A078G679_BRANA; BnaA01g28740D protein
STRINGBra021094.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.12e-73squamosa promoter binding protein-like 5