PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC11643_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 330aa    MW: 36565.4 Da    PI: 5.3554
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC11643_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.1e-18220254135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  RrC11643_p1 220 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 254
                  99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.6E-831308IPR016679Transcription factor, GATA, plant
SMARTSM004018.7E-18214264IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.635214250IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-14215251IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577168.08E-16216278No hitNo description
CDDcd002026.45E-15219266No hitNo description
PROSITE patternPS003440220245IPR000679Zinc finger, GATA-type
PfamPF003201.2E-15220254IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEEEEAHEFL HTADHFAVDD LLVDFSNDDD EENDITVDSD GTNTATAVTD SSNSSSLSPA  60
GLPNFQGDVQ DGTSFSGELC VPSDELAELE WLSNFVEDSF STDDVQKLQL ISGYKARPDP  120
KPEPENPNSN SPIFTTDVSV PAKARSKRSR AAACNWASRG LLMEAVYDNP FTGETILSRH  180
HLSPPTSPTF MTHPAKKQAL DGLRRKKDSL LDSGAEERRC LHCATDKTPQ WRTGPMGPKT  240
LCNACGVRYK SGRLVPEYRP AASPTFVLAK HSNSHRKVME LRRQKEMTKA HHEFIHHHHG  300
TETAMIFDVS SDGDDYLIHH HVGPDFGQLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013643773.10.0PREDICTED: GATA transcription factor 12
RefseqXP_009151105.10.0PREDICTED: GATA transcription factor 12
SwissprotP697811e-172GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A078DG080.0A0A078DG08_BRANA; BnaA06g27920D protein
TrEMBLM4D0660.0M4D066_BRARP; Uncharacterized protein
STRINGBra009864.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66252644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-139GATA transcription factor 12