PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC11342_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TCP
Protein Properties Length: 111aa    MW: 13002.9 Da    PI: 4.5789
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC11342_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP26.91.5e-08751081043
          TCP  10 kihTkvggRdRRvRlsaecaarfFdLqdeLGfdk 43 
                  + hTkv+g++ R ++ a caa +F+L++e G+  
  RrC11342_p1  75 DCHTKVEGKGCRFCMAAMCAACVFELTREPGYGH 108
                  89***************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE patternPS0019708896IPR0060582Fe-2S ferredoxin, iron-sulphur binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051537Molecular Function2 iron, 2 sulfur cluster binding
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MSLEPENMGM REWLKENVKE EEYVVMKAEV DVLEVMMMRR NMETDRYLGT VREDETFRIL  60
LEREPLSGFS NFPQDCHTKV EGKGCRFCMA AMCAACVFEL TREPGYGHYS N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-