PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1116_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 143aa    MW: 16372.8 Da    PI: 8.7969
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1116_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.11.1e-36101101101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++ r+Ca+dC+la yfpaeqpk f+nvh+lFG++ ++k+l++l+e ++++am+s+++++ ar r+P++G++g+ ++lq  +  +++el+++++
  RrC1116_p4  10 ACAACKYQCRRCAADCPLALYFPAEQPKLFQNVHRLFGVRSIVKILENLDEAQKPEAMKSIIFQSYARDRNPIHGCLGITQQLQYMIWLAEEELKAVNS 108
                 7**********************************************************************************************9998 PP

      DUF260 100 el 101
                 +l
  RrC1116_p4 109 QL 110
                 75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9639110IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MTLKGGTSVA CAACKYQCRR CAADCPLALY FPAEQPKLFQ NVHRLFGVRS IVKILENLDE  60
AQKPEAMKSI IFQSYARDRN PIHGCLGITQ QLQYMIWLAE EELKAVNSQL QTYRNNTNTG  120
QYHQNAHKQM IHKIGEKHEY VTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-2461137114LOB family transfactor Ramosa2.1
5ly0_B7e-2461137114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018469901.11e-101PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS67e-74LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A078J5G01e-85A0A078J5G0_BRANA; BnaC01g42830D protein
TrEMBLA0A0D3A9145e-86A0A0D3A914_BRAOL; Uncharacterized protein
STRINGBo1g072490.19e-87(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-76LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]