PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC11093_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 104aa    MW: 11737.3 Da    PI: 9.7929
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC11093_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.81.7e-191650135
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                 Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  RrC11093_p1 16 CSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRL 50
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.9E-171064IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.76E-151072No hitNo description
PROSITE profilePS5011412.2151046IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.5E-161448IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.09E-131563No hitNo description
PROSITE patternPS0034401641IPR000679Zinc finger, GATA-type
PfamPF003201.9E-171650IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
FSGQLLEEHQ QPSRRCSHCG VQKTPQWRAG PMGAKTLCNA CGVRYKSGRL LPEYRPACSP  60
TFSSELHSNH HRKVMEMRRK KEPADDKETG LNQLVQSSQA VPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892251e-117AC189225.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB011P07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607034.17e-64PREDICTED: GATA transcription factor 5
RefseqXP_013607035.17e-64PREDICTED: GATA transcription factor 5
RefseqXP_013607036.17e-64PREDICTED: GATA transcription factor 5
RefseqXP_013688521.17e-64PREDICTED: GATA transcription factor 5-like isoform X1
RefseqXP_013688522.17e-64PREDICTED: GATA transcription factor 5-like isoform X1
RefseqXP_013688524.17e-64PREDICTED: GATA transcription factor 5-like isoform X1
RefseqXP_013688525.17e-64PREDICTED: GATA transcription factor 5-like isoform X2
SwissprotQ9FH578e-63GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A078D2391e-63A0A078D239_BRANA; BnaC09g08090D protein
TrEMBLA0A0D3E2Q28e-64A0A0D3E2Q2_BRAOL; Uncharacterized protein
STRINGBra037173.1-P3e-62(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36982561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-64GATA transcription factor 5