PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC10852_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 197aa    MW: 22305.9 Da    PI: 8.3961
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC10852_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.91.4e-37161161101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++r+kC+++C+la+yf++e++++f n+hklFG+sn++k++k ++e +r+ am+ l+++A+arardPv G+++++l+l++q+++++ael+ l+
  RrC10852_p2  16 ACAACKYQRKKCTENCILARYFAQEKQNQFLNAHKLFGVSNITKFIKGVEECQRDVAMNNLIFHANARARDPVLGVFKIMLDLKNQIACAQAELNFLH 113
                  7***********************************************************************************************99 PP

       DUF260  99 eel 101
                  ++l
  RrC10852_p2 114 QKL 116
                  985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575117No hitNo description
PROSITE profilePS5089124.22615116IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-3416113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MSLSKFHGGS SSSATACAAC KYQRKKCTEN CILARYFAQE KQNQFLNAHK LFGVSNITKF  60
IKGVEECQRD VAMNNLIFHA NARARDPVLG VFKIMLDLKN QIACAQAELN FLHQKLAMCQ  120
TMVLQQQLGC YSYGDLLEQG DQYLNIDGHV HQEIMQKQSP LNYEMFMEMP IKLEKEKISI  180
PGHKNAVNQI AMPSQVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-23101165111LOB family transfactor Ramosa2.1
5ly0_B6e-23101165111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018469529.11e-132PREDICTED: LOB domain-containing protein 7
SwissprotQ9SSM93e-67LBD7_ARATH; LOB domain-containing protein 7
TrEMBLA0A291LR366e-97A0A291LR36_BRARR; Transcription factor LBD7
TrEMBLM4CV176e-97M4CV17_BRARP; Uncharacterized protein
STRINGBra008062.1-P1e-97(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM154661417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.11e-59LOB domain-containing protein 7