PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC10705_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 316aa    MW: 35510.9 Da    PI: 9.1163
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC10705_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.63.4e-55161431128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp+k+k + kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+l++ ++
  RrC10705_p1  16 LPPGFRFHPTDEELISYYLVNKIADQNFTG-KAIADVDLNKSEPWELPEKAKIGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEILNStTS 112
                  79*************************999.88***************99999****************************************98788 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  elvg+kktLvfy+grap+gekt+Wvmheyrl
  RrC10705_p1 113 ELVGMKKTLVFYRGRAPRGEKTSWVMHEYRL 143
                  89***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-6313165IPR003441NAC domain
PROSITE profilePS5100560.84516165IPR003441NAC domain
PfamPF023656.3E-2917143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MEQGDHQQQK KEVEALPPGF RFHPTDEELI SYYLVNKIAD QNFTGKAIAD VDLNKSEPWE  60
LPEKAKIGGK EWYFFSLRDR KYPTGVRTNR ATNTGYWKTT GKDKEILNST TSELVGMKKT  120
LVFYRGRAPR GEKTSWVMHE YRLHSKSSYR TSKQDEWVVC RVLKKAEATK KYISNSSSSA  180
SHHLQSHARA SILSTNNNNP NYSSDLLQLP AHLQPHTSLN INQTLMANAV HLAELSRVFR  240
ASTSSTMDAH QPLMSYNHMP VSGLNLNLGG GLVQPAPPAV SLEDVVAVTA SFHGQNGFGN  300
VEMSQCMDMD GYWPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-571517116171NO APICAL MERISTEM PROTEIN
1ut4_B1e-571517116171NO APICAL MERISTEM PROTEIN
1ut7_A1e-571517116171NO APICAL MERISTEM PROTEIN
1ut7_B1e-571517116171NO APICAL MERISTEM PROTEIN
3swm_A1e-571517119174NAC domain-containing protein 19
3swm_B1e-571517119174NAC domain-containing protein 19
3swm_C1e-571517119174NAC domain-containing protein 19
3swm_D1e-571517119174NAC domain-containing protein 19
3swp_A1e-571517119174NAC domain-containing protein 19
3swp_B1e-571517119174NAC domain-containing protein 19
3swp_C1e-571517119174NAC domain-containing protein 19
3swp_D1e-571517119174NAC domain-containing protein 19
4dul_A1e-571517116171NAC domain-containing protein 19
4dul_B1e-571517116171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064031e-140AC006403.4 Arabidopsis thaliana chromosome 2 clone T28I24 map mi238, complete sequence.
GenBankCP0026851e-140CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018437172.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLA0A0D3DVN00.0A0A0D3DVN0_BRAOL; Uncharacterized protein
STRINGBo8g099810.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68512841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.20.0NAC domain containing protein 38