PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1059_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 116aa    MW: 13543.7 Da    PI: 9.4101
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1059_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260903e-28497295
      DUF260  2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95
                Ca Ck +r+kC+++ vl py+pa++p+++a++  +F ++n++++lk++++++r++ ++sl++eAear+rdPv+G +g+i++ q++ ++l+ e  
  RrC1059_p4  4 CAICKEKRQKCTQKGVLTPYLPANKPESYACLVYVFDVKNLVRILKEIDPSQRQACVDSLCFEAEARIRDPVHGTLGIIRDNQRRNQRLQWEQR 97
                ***********************************************************************************99999987654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.0222106IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-28496IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MELCAICKEK RQKCTQKGVL TPYLPANKPE SYACLVYVFD VKNLVRILKE IDPSQRQACV  60
DSLCFEAEAR IRDPVHGTLG IIRDNQRRNQ RLQWEQRELL SAQRQLSMMN HGRSRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-22410612111LOB family transfactor Ramosa2.1
5ly0_B3e-22410612111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A397YVE54e-49A0A397YVE5_BRACM; Uncharacterized protein
STRINGBostr.6864s0195.1.p4e-28(Boechera stricta)
STRINGXP_010431215.12e-27(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-24LOB domain-containing protein 25