PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC10491_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GeBP
Protein Properties Length: 386aa    MW: 43033.8 Da    PI: 4.5599
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC10491_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573115.33.6e-36196289297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  +fqr+w+eeDei+lLqG+id++++tg+sp+dd +afye +k s+sf+ +k+q++eKir+LKkKf ++  k  ++k+ +fsk+hd ++f lsk +Wg
  RrC10491_p3 196 YFQRVWTEEDEITLLQGIIDYQNETGSSPFDDKNAFYELLKLSLSFTPTKTQFFEKIRSLKKKFDNNHGK--EKKKGAFSKPHDLETFRLSKFVWG 289
                  8********************************************************************9..888999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.1E-30197289IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MNLEPTESSS SYEDDSSSSE EETDSPILKA SLPVTTANSS SSEEEETDSE SETEPVPDSK  60
DGSKPKITAN SLSDSPVVKP DSSSKVVEAP MNTANSESET ETEQEEVEAV KPPPDPSNKV  120
PVTTANSSSE EEPDSPAVKP PTDSNKVETS QKPVTKKRSI ETTMDEGGEA KRIKTVSGGD  180
DDNKKITVFQ ETKKNYFQRV WTEEDEITLL QGIIDYQNET GSSPFDDKNA FYELLKLSLS  240
FTPTKTQFFE KIRSLKKKFD NNHGKEKKKG AFSKPHDLET FRLSKFVWGG DGIMSNAIEV  300
KPPAVLKLVX PXXVKKQEFG VESLARFGVD DLFAKKGWSK LSLEDKKRLE VEWEALQLEE  360
LRFYARKSRF IHDALTKMAE ASQQDH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631648.11e-95PREDICTED: mediator-associated protein 1-like
RefseqXP_013672034.19e-96PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D3C0N81e-95A0A0D3C0N8_BRAOL; Uncharacterized protein
STRINGBra038583.1-P4e-89(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.15e-46DNA-binding storekeeper protein-related transcriptional regulator